SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002423 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002423
Domain Number 1 Region: 196-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000221
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 146-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000669
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 238-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000354
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002423   Gene: ENSDORG00000002579   Transcript: ENSDORT00000002579
Sequence length 304
Comment pep:novel scaffold:dipOrd1:scaffold_35832:9081:11663:-1 gene:ENSDORG00000002579 transcript:ENSDORT00000002579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YEKPLSTSESTHAQELKGQACSRIQMRTPAAGNNCEPNPGGKAFLTLQVKTSTAEMLSAL
ADNPETLIPTPYRRTACLREEPGHRGSGHAFAWPSLQALVTQGEDKLCGGSDSGGPFLSA
GFAMHVASLVEPPYRCEPCAKRSDPAYLGKHMRTHTGERPHRPQGKAFAQYGSLPAHRTH
SAHKYAYKECGKAFTSTCLVTHTRKHMGRKLFLCKQWGKVFTRFFFFCLIEHLRTQVGEK
PSKCEACRKAFAHCSNLHQRTHAEKPCDCKICMCVFTSSSPNNHTQTHKALTLSREFQRE
CEKV
Download sequence
Identical sequences ENSDORP00000002423 ENSDORP00000002423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]