SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002459 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002459
Domain Number 1 Region: 2-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-84
Family BAR domain 0.00047
Further Details:      
 
Domain Number 2 Region: 403-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.93e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00023
Further Details:      
 
Domain Number 3 Region: 263-366
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-27
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 4 Region: 670-786
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.22e-25
Family Ankyrin repeat 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002459   Gene: ENSDORG00000002616   Transcript: ENSDORT00000002617
Sequence length 832
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2720:6867:25193:-1 gene:ENSDORG00000002616 transcript:ENSDORT00000002617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECIKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMIEAGKAYVATNRLFVSG
IRDLSQQCQGDAVISECLQRGDSLQEMVNYHTVLFDQAQRSVRQQLHNFVKEDVRKFKET
KKQFDKVREDMELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQAK
KKFEILDSMLSFMHAQYSFFQQGHNLLHQLDPYMKKLAAELDQLVIDCAVEKREMERKHA
AVQQRXXXXXXXXXXXKVEFDGDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQ
KKLKDVLTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQAS
IASAYRESPDSCYSERLDRTASPSTSSIDSTTDPRERGAKGESVLQRVQSVAGNGQCGDC
GQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNTTVNQ
IYEAQCEGLGSRKPTASSPRQDKEAWIKDKYVEKKFLRKLPTAPAREAPRRWRARKCQRP
NSSPHAPTARRKVRLEPVLPSMAALSAAGTLERKFRRDSLFCPDELDSXXXXXXXXXXXX
XXXXLSSDSGLGGSSDGSSDVLAFGTGSVVDSVTEEEGVESEESSGEAEAEAEAWRLSDV
RELHPGLLAHRAARARDLPALAAALAHGAEVNWVDTEDEGKTPLVQAVLGGSLIVCEFLL
QNGADVNQRDSLGRAPLHHATLLGRTGQVCLFLKRGADLHAVDQEQQDPLSIAVQVANAD
IVTLLRLARMAEEMREAEASPGQPGALSGSSPTELQYRKCIQEFIGLHLEDS
Download sequence
Identical sequences ENSDORP00000002459 ENSDORP00000002459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]