SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002461 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002461
Domain Number 1 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 184-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000878
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 449-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000715
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002461   Gene: ENSDORG00000002620   Transcript: ENSDORT00000002619
Sequence length 508
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4466:10204:52198:-1 gene:ENSDORG00000002620 transcript:ENSDORT00000002619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQPNPELKNSQEQPVPTESPTASSDYSLTKPHEIENVDSAEGPANEDDDVGDDLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXERPFQCNQCGASFTQKGNLLRHIKLHTGEKPYKCHLCNYA
CQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSSDLGDAXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRQCFDGNYNSNYMYEKESEIIQTR
MMDHTINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGTPQELEKK
TTHLPEKSLPSERGLSPNNSGHDSTDTDSNHEERQSQLYQQSHLVLPRARNGMPLLKELP
RSYDLLKPPPICPRDSINVISKEGEVMDVFRCDHCRVLFLDYVMFTIHMGCHGFRDPFEC
NMCGYRSHDRYEFSSHIARGEHRVMLKR
Download sequence
Identical sequences ENSDORP00000002461 ENSDORP00000002461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]