SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002470 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002470
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-22
Family C-type lectin domain 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002470   Gene: ENSDORG00000002631   Transcript: ENSDORT00000002628
Sequence length 96
Comment pep:novel scaffold:dipOrd1:scaffold_145744:837:1573:-1 gene:ENSDORG00000002631 transcript:ENSDORT00000002628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEAEASFVSSLVKSTVNNYQYIWIGLHDPTLGQSPNGDGWEWSNSDVLNFFNWDRNPST
APDRGYCGSLSSNSGFLKWRDVQCDVQLPYVCKFKG
Download sequence
Identical sequences ENSDORP00000002470 ENSDORP00000002470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]