SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002539 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002539
Domain Number 1 Region: 1073-1125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 650-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000509
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 388-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000112
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 945-993
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000985
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 687-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000797
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002539   Gene: ENSDORG00000002702   Transcript: ENSDORT00000002702
Sequence length 1262
Comment pep:novel scaffold:dipOrd1:scaffold_9014:33490:38543:-1 gene:ENSDORG00000002702 transcript:ENSDORT00000002702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGGAEDADSGQDSRSGGEETSVCERCCAEFFKWTDFLRHKESCAEHPLVLIVREDEPAP
PADDLPEPSPASSAGGERADSEAAAEEAGAPEAGEGKAVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPDAVAGPGPAAAPSTAFEGPQALRSGSGDPEEPGALAASAAGPGAAASASETGAASQP
QSASTSPALAPGPPPGSGPGLPNPLLPQTSAAGGGGSSVIFPNPMVSIAATANALDPLAA
LMKHRKGKPPNVSVFEPKASTEDPFYKHKCRFCAKVFGSDSALQIHLRSHTGERTFKCNV
CGNRLSTKGNLKVHFQRHREKYPHIQMNPYPVPEYLDNVPTCSGIPYGMSLPPEKPVTTW
LDSKPVLPTVPTSVGLQLPPTVTGTHSYSDSPSVTPASRSPQRPSPASSDCMSPGLGHTE
SGLAGPAESPQPLLGGPALTKTEPVSLPCASARTGEAPVVAGQVGGLPTSSATTVTDSAS
ASLGSPGLPAVSDQFKAQFPFGGLLDSMQTSETSKLQQLVENIDKKMTDPNQCVICHRVL
SCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQRKF
TNAVVLQQHIRMHTGGQIPNTPLPDGFQDARDAELSAETLSGYDDDIDDNSMEEDAELKD
TASDSSKPLLSFSGSCPPSPPSVISSIAALENQMKMIDSVMNCPQLAGLKSVENGSGDSD
RLSNDSSSAAGDLESRSAGSPALSESESSQAPSPANSHGESFRSKSPGLGAQEDPQEIPL
KTERPDSPPAGPGNGGAPGRPAIKEETPFGLLFLNRERGKCASTVCGVCGKPFACKSALI
HHRSHTKERPFVCTVCRRGCSTMGNLKQHILTHRLKELPSQFDPNSTLPSHSTPGLASPT
PTMIKMEVNGHVKARVPGEVPPLPAGVPLHTPQAVMSPGLAPMMAPPPRRTPKQHKCQSC
GKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNAPARRGRRLSV
DNPMALLGGDALKFSEMLQKDLAARAMNVDPSFWNQYAAAITNGLAMKNNEISVIQNGGV
PPLPVSLGGGAIPPLGAGTGAVDKLRTGSSPPMVSLDKASSEAGTGRPFTRFIEDNKEIG
IN
Download sequence
Identical sequences ENSDORP00000002539 ENSDORP00000002539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]