SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002560 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002560
Domain Number 1 Region: 414-652,684-750
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.26e-49
Family Diacylglycerol kinase-like 0.02
Further Details:      
 
Domain Number 2 Region: 31-55,131-198
Classification Level Classification E-value
Superfamily EF-hand 9.62e-18
Family EF-hand modules in multidomain proteins 0.065
Further Details:      
 
Domain Number 3 Region: 203-272
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.47e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 276-321
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002560   Gene: ENSDORG00000002719   Transcript: ENSDORT00000002725
Sequence length 779
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3050:32850:333641:-1 gene:ENSDORG00000002719 transcript:ENSDORT00000002725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STKKLKDVLEEFHGNGVLAKYNPEGKPDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLF
MSFSNKFPHSSPMVKSKPALLSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXMFRLYDSDGNGFLDSSELENIIGQMMHVAEYLEWDVTELNPILHEMME
EIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVKDDGQHVWRLKHFNKPAYCNLCLNM
LIGVGKQGLCCSFCKYTVHERCVARAPSSCIKTYVKSKKNTDVMHHYWVEGNCPTKCDKC
HKTVKCYQGLTGLHCVWCQITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXERQSTVKKEKGSSQQPNKVTDKNKMQRANSVTVDGQGLQITPIPGTHPLLVFVN
PKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWIL
DCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILRDIEISTEIMLDRWKF
EVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFG
TSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR
RIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCS
SVVIXXXXXLPMQIDVPWMQTPCTIKITHKNQAPMLMGPPPKTGLFCSLVKRTRNRSKE
Download sequence
Identical sequences ENSDORP00000002560 ENSDORP00000002560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]