SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002593 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000002593
Domain Number - Region: 342-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00162
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002593   Gene: ENSDORG00000002760   Transcript: ENSDORT00000002763
Sequence length 781
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4060:89034:228628:1 gene:ENSDORG00000002760 transcript:ENSDORT00000002763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAMWCGRSLDLSPCGSAPPETTKDILVIHEDDVEEWAFYLREIFLHVVKQEAILLYPL
ETFSLRPRELLSLNSYKCKLLIISNRLLKDLTPKKCQFLEKVLHSPESVVTLLCGVESSN
QLYKLLHISQSRWEMSTEQEPDDIISVIKQIIFRESEGYLEVNTQAHLRVQHSGENHERK
ERKDSEVSTSTGPLALVLPDEIPCENPGEIFILLRDEVIGETLEIEFVSNYKHIIKQPTR
WNKKVWSMKALDFPAGSVIVKVYCDGNIKATTEIKYYTTAKTKECPLSMASLGDSLCQGN
MEDLDGILATIFKHEIPYYEFQSLPTEIYSKEEYTHVKELPTLLHCGAKFGLRNLATHLL
QCPGARWASQTKNTDGFDPAHIAERHGHKELKKIFEDFAXXXXXXXXXXXXXXXXXXXXX
XXXXXXTQYSACHLGKRKTHRPTANGAEKSERAMEGKENESSAEAKHSQPEVDTNSSENQ
YDDLYVFIPGINLENNPQQPLTCGRPPLPPPRLVSPASQLERPHFKIQGKIVEDQMERRE
IWSDPFNVKQDTRDEPKGEEKEKDEKEQEEDEDPYTFAEIDDNEYDMILAHMSIKKKTGS
RSFIMNRPPAPTPRPVNILPSEEKTPYIAQVFQQKAARRQYDSDKFHGLPKKPDRVQMES
PAFPIPRDCLTVRQEELISLQEKVKNGKMSVDEALEKFKHWQMNKSGLEMIQQEKLRQLR
DSIIGKRPEEENVYNKLSIVHRPSGNTAHNENMLYRIPFSNELPARLQVEKEFGFLSSKD
H
Download sequence
Identical sequences ENSDORP00000002593 ENSDORP00000002593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]