SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002662 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002662
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000119
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002662   Gene: ENSDORG00000002833   Transcript: ENSDORT00000002833
Sequence length 890
Comment pep:novel scaffold:dipOrd1:scaffold_3023:45693:48398:1 gene:ENSDORG00000002833 transcript:ENSDORT00000002833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGSGFLSGGGGGSGSSGGGGGPGSGSGGGGGGGRRAEMEPAFPPGMVMFNHRLPPVTS
FTRPAGAAAPPPPCVLSSAASAAPAAEPPPPPAPDMTFKKEPAASAAAFPAPRTSWGFLQ
SLVSIKQEKPADPEEQPPHHHHQHHHYAGLFAAGAEERSPGLGAGEGGGHGVIQDLSVLH
QHVQPQQAGQHHRDVLLSGGGRTDDPGSEEPKQDTNVKKAKRPKPESQIAKRKPSASSKP
SVGDGEGAILSSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCGQCSMGFIQKYLLQ
RHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRR
TCGEAIAKGATSAEPGSSNHNSMGNLAVLSQGNTSSSRRKSKSKSIAMENKEQKTGKASE
SQISNSINMQSYSVEMPTVSASGGLIGTGIDDLQKRVPKLIFKKGGRKNTDKSYLNFVSP
LPDLVGQKALSGKPGGSLGIVANNSAETISLLQSTSGKQGQISSNYDDAMQFSKKRRYLP
TASSNSAFSINVGHMVPQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKACHDKSGIPDE
VLQSILDQYSNKSESQKEDPFSITEPRVDLHASGEHSELVQEENLSPGTQTPSNEKPSSL
QEYSKYLQQAFEKSTNASFALGHSFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVT
SVLPSSLPKPPFGMLFGSQPGLYLSALDAHQQLTPSQELDDLIDSQKNLETSSAFQSTSQ
KLTSQKEQQKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRV
PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
Download sequence
Identical sequences ENSDORP00000002662 ENSDORP00000002662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]