SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002699 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000002699
Domain Number - Region: 42-94
Classification Level Classification E-value
Superfamily BRCT domain 0.000288
Family DNA-repair protein XRCC1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002699   Gene: ENSDORG00000002874   Transcript: ENSDORT00000002875
Sequence length 537
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4475:1676:34816:1 gene:ENSDORG00000002874 transcript:ENSDORT00000002875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSEPRGCVYRTRESSMAESKLRAPDQGARPGVSSCQRKCQKSAKRQPFSGKSFYLDLPAG
KHLQFLTRAVQQLGGVIEGFLSKEVSYIVSSRREAKAERNGTSHRGRPSSSEVRVETASL
ANPKGYQATPSQKPVDSVPLSRGKELLQKAIKKQGSSSSSLLTNARSWGVKVLHVDKMMM
HVRQLSIGGSSHTKKQEPKKPEGTRPGVESRARKVARLKSPFLKIEDVSRKFRPFHRQFK
SFPEISFLGPKAASPFQALTTPSSLQHSRELRDPEPSLRSAVHTLPRRKKGYCECCKETF
ADLHVHLQSAQHQSFALEAHPYAEIDRIIAQLSQSFVDISQASLPRQSGSPASNRDILCS
DTPPLSRPCQPRTASTRMRKEDGGQTPLTQGRGEGLANVTTLLWPQARGSEGILPHLDNP
LPGDSPTEGMLHPCQEHSLTGISAPGPAQFPVRLGLALRLCKPFPFVMCNQLVSEVSSCP
LRPHWHLHMRHTSPRNQLLPISPTRPIPTAQLAHLKDCDLHLLLSFVYSSLYTVELH
Download sequence
Identical sequences ENSDORP00000002699 ENSDORP00000002699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]