SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002756 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002756
Domain Number 1 Region: 121-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-28
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 48-119
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-23
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002756   Gene: ENSDORG00000002933   Transcript: ENSDORT00000002933
Sequence length 264
Comment pep:novel scaffold:dipOrd1:scaffold_1035:20031:73206:-1 gene:ENSDORG00000002933 transcript:ENSDORT00000002933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHGSAVRVGAGGRRPAEHPGRRSGGAAGAPASREAILISLFPRCAAPGSAMSKPPPKPVK
PGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTCKGRTGLIPSNYVAEQA
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDVVEVLFTQSN
IELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNNEKKLALDMATNAACASLLK
KKQGTDAVRTLSNAEDYLDDEDSD
Download sequence
Identical sequences ENSDORP00000002756 ENSDORP00000002756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]