SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002791 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002791
Domain Number 1 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 96-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000151
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002791   Gene: ENSDORG00000002972   Transcript: ENSDORT00000002970
Sequence length 190
Comment pep:novel scaffold:dipOrd1:scaffold_21567:15496:20120:-1 gene:ENSDORG00000002972 transcript:ENSDORT00000002970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSR
SRKDDDSLAEASHSKKTVKKVVVVEQNGSFQVKIPKNFICEHCFGAFRSSYHLKRHILIH
TGEKPFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQ
SKTSDGQFAL
Download sequence
Identical sequences ENSDORP00000002791 ENSDORP00000002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]