SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002869 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002869
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.79e-35
Family SCAN domain 0.0000882
Further Details:      
 
Domain Number 2 Region: 342-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000188
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002869   Gene: ENSDORG00000003055   Transcript: ENSDORT00000003054
Sequence length 371
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6125:5:2489:-1 gene:ENSDORG00000003055 transcript:ENSDORT00000003054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMRELKTNVCLSPRRGAVWETKESAEDNASQIKKSCPQIESLRPESAHHHFRSFCYHEA
TGPLEAVHQLQALCYKWLRPESHSKEQILELLVLEQFLAILPKETQNWVQKHHPQNIRQA
VDLVERLQREPGGKQNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKLKKNTGNDQPKSVTASEIQAPKK
TRAKVAQKTAGKEKHDDTHIVQTQGQDFTRKKRKRVSTCEQEVQRHKRSHTGEKPFKCQE
CGNSFRVSSDL
Download sequence
Identical sequences ENSDORP00000002869 ENSDORP00000002869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]