SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002906 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002906
Domain Number 1 Region: 449-614
Classification Level Classification E-value
Superfamily Kelch motif 1.01e-16
Family Kelch motif 0.017
Further Details:      
 
Domain Number 2 Region: 125-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000314
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 3 Region: 803-873
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000849
Family C-type lectin domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002906
Domain Number - Region: 298-326
Classification Level Classification E-value
Superfamily Kelch motif 0.0157
Family Kelch motif 0.032
Further Details:      
 
Domain Number - Region: 248-324
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0837
Family Galactose oxidase, central domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002906   Gene: ENSDORG00000003098   Transcript: ENSDORT00000003101
Sequence length 1375
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1532:587:410883:1 gene:ENSDORG00000003098 transcript:ENSDORT00000003101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGVPARTGIPKPAVPGLWRARPAGGGGGGGASSLPDGNSWLLCYGFLYLALYAQVSQS
PCKRTGSCFSGQCVNSTCLCDPGWVGDHWLCRAGLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEVRGNETVPEVVT
TSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVASQVYCECDKYWKGE
ACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPS
VGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSNTWLVPETKGAIVQGGYGHTSVYDEITKSIY
VHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHN
DTSLSNGAKCFSADFLAYDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMYIFGGFSSV
LLNDILVYKPPNCKAFRDEELCKNAGPGIKCFWNKNHCESWESGNNILRAKCPSKTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVRNYTKCHVRNEQICNKLTSCKS
CSLNLNCQWDQRQQECQALPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXKISPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDS
GFCAYLERAAVAGLKANPCTSMVDGLVCEKPVVSPNQNARPCKKPCSLRTTCSNCTSNGM
ECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTCSGHANICHLHTGKCFCTTKGIK
GDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNL
DISINASNNFNLNITWSMGSTGGTISGEETPIVSKTNIKEYRDSFSYEKFNFRSNPNITF
YVYVSNFSWPIRXXIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRR
EQLLRERQQMASRPFASVDVALEVGAEQTDFLRGSLEGVPKPIAIEPCAGNRAAVLTVFL
CLPRGSSGAPPPGQSGLAIASALVDISQQKPSDNKDKTSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences ENSDORP00000002906 ENSDORP00000002906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]