SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002953 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002953
Domain Number 1 Region: 791-899
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 265-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 226-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000011
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 4-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 132-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 674-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000068
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002953   Gene: ENSDORG00000003155   Transcript: ENSDORT00000003156
Sequence length 927
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3719:10574:33547:1 gene:ENSDORG00000003155 transcript:ENSDORT00000003156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDECVEGTDHCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNI
PGNYRCTCYDGFHLAHDGHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGQH
TCDDXXXXXXXXXXXXXXXXXXXXXXXXERRIEQHTPPQAVSNETCAVNNGGCDSKCHDA
ATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHLCRNTVGSFECSCKKGYKLLINER
NCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGVTHCGDVDECSINRGGCRFGCIN
TPGSYQCTCPAGQGRLHWNGKDCTEPVKCQGNPGASKAMLSCNRSGKKDTCALTCPSRAR
FLPESENGFTVSCGTPSPKAAPARAGHPGNSTSSSHCHEAAALSVKQRASFKIKDAKCRL
HLRNKGKPEEASRVPGPGGAPCSDCQVTFIHLKCDSSRGKGRRARTSPGKEVTRLTLVLE
AVRAETTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQCPPGQHSADGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGA
VSFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCTRCPGNTSTDFDGSTSVA
QCKXXXXXGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDEC
GDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYD
EDYEQLVEDIVRDGRLYASENHQEILK
Download sequence
Identical sequences ENSDORP00000002953 ENSDORP00000002953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]