SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002987 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002987
Domain Number 1 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 250-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 39-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-17
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 216-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000253
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002987   Gene: ENSDORG00000003193   Transcript: ENSDORT00000003193
Sequence length 519
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4680:2588:21516:1 gene:ENSDORG00000003193 transcript:ENSDORT00000003193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTDLVEVSKTRASSSQDSPLSQEKSPEEGEVTALHLTARSQERVTFKDVAMDFTPEEWG
KLDPTQRDVMLENYRNLVSLWLPISKPENYNLDNSKEPLKLEKKVSKCSYSDLESRPESK
DSTSIQDLFKNESHHVTVKDRLTSVHDSTLETALECKNWLENQQGNQERHLREMFMHLNA
LPDERGHEQDVYWKSCNQKSLLMTQNRVPKGSCAFHTVGKQLKQKSNLMNKERTHKEKKP
HKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNDCGKSFSHRANLTKHQRTHTRILFECNE
CKKTFTESSSLAIHQRIHIGERPYECSECGKGFNRSTHLAQHQLIHTGVKPYECNECDKA
FIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFSQS
THLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHIGKKPYKCSECGKAFIHSSALI
QHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRIHTGEQP
Download sequence
Identical sequences ENSDORP00000002987 ENSDORP00000002987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]