SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003002 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003002
Domain Number 1 Region: 1568-1658
Classification Level Classification E-value
Superfamily BRCT domain 2.49e-21
Family BRCT domain 0.045
Further Details:      
 
Domain Number 2 Region: 29-136
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.3e-16
Family FHA domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003002
Domain Number - Region: 1665-1749
Classification Level Classification E-value
Superfamily BRCT domain 0.00141
Family BRCT domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003002   Gene: ENSDORG00000003207   Transcript: ENSDORT00000003208
Sequence length 1760
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6616:138998:156005:-1 gene:ENSDORG00000003207 transcript:ENSDORT00000003208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQTINWDAEEEEETEQSRGSLGHSSEPVGQLRIFSGTHGPEKDFPLYLGKNMVGRSP
ECAVTLPFPSISKQHAVIEILAWNKAPILQDCGSLNGTQILRPPKALSPGVSHRLRDKEL
ILFADFPCQYHRLDVPQPVVSQGPLTVEETPRVQGGTQPSRLLVEDSEEEVDFVSERCVT
KESATTSSPLPTVVPESDEEGPSPAPGGSGTSFPFNLDSDTDEEKDQQPATVETALSSRK
DTTAEAEQPEASGVPTTVRLVKAQSSVENDQGTKIKNVGNGEILKRSQPPEDSDTDVDEE
DRSPGRAADVHLERAQTSGFVDSDTDMEEEGIPATPIVPMKKRQIFHGVGTKDPGTPGVA
HVQESPTGSDTDVEEGKAPLAVPAERNQTSVVINSDTDDEEEVSAALTLACLKENGSVLW
DRGTGMGADREQPVVLQEQSHIDSGKDSDTDMEEEWLSVEKKETVPSGHTDKGGALVIAD
SEKDQLSFSNSDVGEKTDLSSSRIHLQRSQNSSSTVMGNNTEMEEEVPSGPVVTNQEGTN
GTNQIDVEAGGSLAKMPVPLEEDGLLENWDTNVIEDRSLVVADVKKNQHLEKENPRPADV
FEQEQALEVVTQSGAPMTQVEQILLHPVKPTQSQREGAQTPTGRGEKAHKGRTKDSKDNY
DDPEDLDLQATQCFVERENQSVEVVQRMEDEPTQAFTCTLPQEPSPSQTPGAPDEPWEVL
ATQPFCLREVEVSEPQPTAAHFEVHRSCQSPSRAVSRDQHPENPVHTEPLEIEGKGMQTV
EKVMDTPKGTAERVQPEKWLSEREIKGWPSDSEKEDVTGEKELTREIEDKEQNQMLAGAV
QTQEFDTKVKSVSPKRDRESLALEMETSKEIQKRKKEALTREVLERQEDKPVPKKKCKPA
ELEVNLDRGEADTGSQNQKGQATSPTPEFRVEAGRLQGLTSGPIVSESQPGGRRRALVNP
RRQQRXXXXXXXXXXXXXXXXXXXXXXXXGEPESPDACLPLSEVSAPPHSPGYLAPQPFL
PPSPSSSEAPTLSKRHSGSQEAPETPLSSESFHPKHIVRPRRSSRTTPSPLSTAPTTPID
QPIPPEPTYQATRTRTRRTSVKTPEPVVPIAPELQSSTSTKPVSHATRGRALRSSAKTPG
PVIPSGLELQSCISTVQLVTPEPTSHTTRGKTRRSSIQTSRPVVPTGPELQPSTSTAQPV
TPKTTSHTTRGKTRRSSVQTPGPVAPTGPELQPSTSTVQPVTPKTASEATQDRTHGSFDE
TPETVVSIGSKLLPSPSTEQHPVTSGPTSRATRGRKNRSSVKTPESVIPTDPDLQPSTSV
VQTVTPKPTSRTTRSRCKSSILTSDPEPFTSIDQPVIPETITHNRTLKFSSVSATPVVAT
SEVPPVTIAQPVPLEPMPQANRSRKQDAGKHGSLTPVNLKPCPAPPESKPESSNNQRPGA
ARAVESFGTIPEPASHQLPQAPTHAPRNQKIKTESTSGFTPEPLPKFSQIRKRPSATEGS
PPLQKRPQKTVFLKEEEDTVEEPGKEEDTVIPGPGKRKRDQAEEGPKGPSRSLRRAKPSQ
GSAPKVLFTGVVDARGERAVLALGGTLANSVTDASHLVTDRIRRTVKFLCALGRGIPILS
LDWLYQSRKAGHFLPPDEYLVTDPEQEKNFGFSLRDALSRARERRLLEGYEIHVTPGVQP
PPPQMGEIISCCGGTILSNMPRLYKPQRVVITCPEDFPRCSIPCRVGLPLLSSEFLLTGV
LKQEAKPEDFVLSNAEMSST
Download sequence
Identical sequences ENSDORP00000003002 ENSDORP00000003002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]