SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003037 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003037
Domain Number 1 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 151-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000181
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 102-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000163
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003037   Gene: ENSDORG00000003245   Transcript: ENSDORT00000003245
Sequence length 264
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5760:6051:8136:-1 gene:ENSDORG00000003245 transcript:ENSDORT00000003245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVRPEPRIPSSPTPESASPEPPDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCHVCGLRCPGPAGLRAHY
RLHTGEQPPRCLRCPRACQPGATAGAAAAAGKPFACRFCAKPFRRSSDLRDHERVHTGER
PYHCGVCGKGFTQSSVLSGHARIHTGERPFLCALCGRAFNNSSNFRKHQRTHQSGPRDIG
GPPGGALRPTNERRGGPAAARGRG
Download sequence
Identical sequences ENSDORP00000003037 ENSDORP00000003037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]