SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003038 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003038
Domain Number 1 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000782
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 128-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000268
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003038   Gene: ENSDORG00000003247   Transcript: ENSDORT00000003246
Sequence length 172
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5760:20427:20945:1 gene:ENSDORG00000003247 transcript:ENSDORT00000003246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPPRPSHPRSSSPEVMDPPPPQTPPFPKAEGPSSAASSAAGPRPPRLGRHLLIDANG
VPYTYTVPLEEEPRGPPPREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH
Download sequence
Identical sequences ENSDORP00000003038 ENSDORP00000003038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]