SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003135 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003135
Domain Number 1 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 5-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-22
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 7 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 8 Region: 175-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003135   Gene: ENSDORG00000003353   Transcript: ENSDORT00000003353
Sequence length 538
Comment pep:novel scaffold:dipOrd1:scaffold_25081:6017:19397:-1 gene:ENSDORG00000003353 transcript:ENSDORT00000003353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFAKVTFEDVAVLLSQEEWNQLGPAQRGLYRNVMMETYGNVVSLGLPGSKPSVISQLER
GEDPWVLDGPGAEESQGLGQSLSDSLKCDHTADCMQQDSLSCPWKCKTKEENQTIDLSLK
PLASNEVTVIPGKTHVGRTEQEHHQTEQSFCLSSNPVGSHKLPVTKHQTASSGDRPYMCI
QCGKCFSRSSHLLQHQRIHTGEKPYVCNICGKAFSQSSVLSKHRRIHTGEKPYECNECGK
AFRVSSDLAQHHKIHTGEKPHECLECRKAFTQLSHLIQHQRIHTGERPYVCPLCGKAFNH
STVLRSHQRVHTGEKPHGCSECGKTFSVKRTLLQHQRVHTGEKPYTCSECGKAFSDRSVL
IQHHNVHTGEKPYECSECGKTFSHRSTLMNHERIHTEEKPYACYECGKAFVQHSHLIQHQ
RVHTGEKPYVCGECGHAFSARRSLVQHERIHTGEKPFQCTECGKSFSLKATLIVHLRTHT
GEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECGECGRAFNQHGHLIQHQKVHKKL
Download sequence
Identical sequences ENSDORP00000003135 ENSDORP00000003135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]