SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003148 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003148
Domain Number 1 Region: 438-578
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-55
Family Myotubularin-like phosphatases 0.00000828
Further Details:      
 
Domain Number 2 Region: 152-261,307-371
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.24e-51
Family Myotubularin-like phosphatases 0.000042
Further Details:      
 
Domain Number 3 Region: 51-131
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000116
Family GRAM domain 0.036
Further Details:      
 
Domain Number 4 Region: 1112-1138
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000767
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003148   Gene: ENSDORG00000003365   Transcript: ENSDORT00000003366
Sequence length 1138
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1098:4715:51637:1 gene:ENSDORG00000003365 transcript:ENSDORT00000003366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEETGHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRLH
IKFKESLVNVPLQLIETVECRDIFQLHLTCKDCKVIRCQFSTFEQCQDWLKRLNNAIRPP
AKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISNI
NEKYKLCGSYPQELIVPAWITDKELESVASFRSWKRIPAVVYRHQNNGAVIARCGQPEVS
WWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNSSRDFPNGADLSDVEFDSSLSNASG
AENLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQS
LRLLCTQMPDPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWLD
CVHQLQRQFPCSFEFSEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLLR
AGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDESCAPYPAPGTSPD
EPPLSRLPKTRSFDNLTTACDSTMPLASRRSSDPSLNEKWQEHRRSLELSSLAGPGEELP
THAADSLGKPSRMPGGAELSVAAGVAEGQMENILQEATKEESGAEEPPHRGGVEIPEVKE
ETLLAKESRRMSAEGSLVLYQEPELEDATPQSQPDSSMSLFSQGIPQQQGGHSVLSSLQA
PSRGEDSQGTPGEPPRIRDATEGREGAVLIPVDAKVGHGTSQSSSMLPSQIPCETGGPNV
DSSVDVLRYVTSESGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIPDSES
NLDQSCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLASRKHHC
Download sequence
Identical sequences ENSDORP00000003148 ENSDORP00000003148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]