SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003230 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003230
Domain Number 1 Region: 223-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000356
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 374-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000945
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003230
Domain Number - Region: 410-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00302
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003230   Gene: ENSDORG00000003451   Transcript: ENSDORT00000003451
Sequence length 458
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1390:63242:65544:-1 gene:ENSDORG00000003451 transcript:ENSDORT00000003451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKAGSAPRRVDLAPAANPDDEMETSDLIIDVKPEPEPHFLRALGLGSCAHNELSTTE
RRFGGEPQKQSPGFRPSFQASGSRNHWAVWMPVTDKSTDNHADLMTCSRCLKNFPWDAIT
ASLDPKKXXXXXXXXXXXXXXXXXXXXXXXXXXXCGRQFTEAWKLLRHAQWDHGLSIYQT
EPESPEAPLLGLAEVAAAMSTQVERPAEIKSPGPSGTDRRTPTCSVCKKTLSSFSNLKVH
MRSHTGERPYACDQCPYACAQSSKLNRHKKTHRPLPILGPEQASPAPPEPAAHAAAPASA
LPSPGAQGTGAAATAGVQEPGAPSSGAQAGPGGDGWDPVPQGQSADTNKSQSAEPKKMPK
AVSKGKRPRPGGSCEFCGRHFSSSSNLTVHRRSHTGERPYACSQCPYTCAQSSKLNRHRR
THGPGPDCARYECPLCAVPFGLRATLDRHLRQKHPRVA
Download sequence
Identical sequences ENSDORP00000003230 ENSDORP00000003230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]