SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003296 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003296
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-36
Family SCAN domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 319-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 462-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 406-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003296   Gene: ENSDORG00000003522   Transcript: ENSDORT00000003522
Sequence length 516
Comment pep:novel scaffold:dipOrd1:scaffold_8490:32876:39703:1 gene:ENSDORG00000003522 transcript:ENSDORT00000003522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALGCAIQASLNQGSVLQEYDTDCEVFRQRFRQFQYTEAAGPHEAFNKLWELCCQWLK
PKMRSKEQILELLVLEQFLTILPTEIETWVREHCPENRERVVSLIEDLQRELEIPEQQVN
MHDMLLEELAPVGTVPMPPNMHLESPALQVMGTVQDPPVAEAWIPQPGPQEMDYGAAGQC
QPFLDPGYPLPKLDVNFPLDHREEPWVKELQDSKEMKQLLDSKIGFELGIENEQDASKQK
KLENMYPFIVTLEGNALQGPILQKDYVQLDNQWEPPPEDLQTDLEKLVDPPNPTLGETPE
TSSLEEPLNPKPQKKKNPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRF
LRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS
SLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQRTHTERPFCNYCGKSFRQRPSLVIHL
RIHTGEKPYKCSHCSKSFRQRAGLIMHQVTHFRGLL
Download sequence
Identical sequences ENSDORP00000003296 ENSDORP00000003296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]