SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003340 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003340
Domain Number 1 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 190-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 382-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003340   Gene: ENSDORG00000003572   Transcript: ENSDORT00000003571
Sequence length 447
Comment pep:novel scaffold:dipOrd1:scaffold_31300:10124:15323:-1 gene:ENSDORG00000003572 transcript:ENSDORT00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLTFKDISVDFTQEEWGQLVPTYRNLYREVMLENYRNLVSVGYQLSKPSIISQLEKGEE
PWMRVNEGPGDPILDLKNKTETSESTAKNDISQEQLYHDMVGRLIRDDIIYSTLNKVSRY
DALERHQETCTRQVILNRKKIGQVAKKCRGNIVSSKVTLEQKHHKFSPPRKRNKCKINLI
NHPISCLRTKIYECNICEKMFKQPIHLTEHMRIHTGEKPFRCKECGRAFSQSASLNTHQR
IHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPFACDKCQKAFSQNISLIQHLRTHSG
EKPYTCNECGKTFRQIRHLSEHVRIHTGEKPYACNACCKTFSHRAYLTHHQRIHTGERPY
KCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHSGEKPYECNE
CGKSFSYNSSLSRHQKIHRRNALRNNL
Download sequence
Identical sequences ENSDORP00000003340 ENSDORP00000003340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]