SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003417 from Dipodomys ordii 69_1

(show help)
Strong hits

Sequence:	ENSDORP00000003417
Domain Number 1	Region: 128-200
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	1.11e-17
Family	Complement control module/SCR domain	0.00011
Further Details:

Domain Number 2	Region: 189-251
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	5.84e-17
Family	Complement control module/SCR domain	0.00012
Further Details:

Domain Number 3	Region: 63-138
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000144
Family	Complement control module/SCR domain	0.00014
Further Details:

Domain Number 4	Region: 2-68
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.000000000005
Family	Complement control module/SCR domain	0.00015
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSDORP00000003417 Gene: ENSDORG00000003652 Transcript: ENSDORT00000003652
Sequence length	327
Comment	pep:novel genescaffold:dipOrd1:GeneScaffold_6312:16868:30742:1 gene:ENSDORG00000003652 transcript:ENSDORT00000003652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	DCGLPAQVPNAQPTLGDLQSFPEGHTVTYKCKEGFEKIPGKPDSVVCLPSHQWSELGEFC NRSCKIPPRLNYAFLKKEYSKQNYFPVGSIVEYECRPGYRKDITKSEKLTCLPSLEWSKP TEFCQKRSCPNPGEIQNGAINIKTDILFGSSISFSCNKGFKLVGATSSYCVLTDNTVGWS DPLPECVEIYCPDPPVVKNGIMRGESNTYTYSQTVSYECTKGFTLVGNSSLYCDIKDDDH GEWSSPPPQCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXVANYLY
Download sequence
Identical sequences	ENSDORP00000003417 ENSDORP00000003417

SEARCH