SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003450 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003450
Domain Number 1 Region: 30-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 2 Region: 72-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 408-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000151
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 447-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000266
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003450
Domain Number - Region: 353-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0791
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003450   Gene: ENSDORG00000003689   Transcript: ENSDORT00000003688
Sequence length 492
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5762:3456:7181:-1 gene:ENSDORG00000003689 transcript:ENSDORT00000003688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDALAPSPAPAPPAATPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFK
HSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSI
LGRHLKRQHRDALLAPLRPIPGLPALGDPCVVCCNTARCSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGHLEAHACPATTGCG
HCGELYAGLAALEEHRRVSHGEGGGGAEAAAAWGPGEPTPSAGRSTKKIFGCSECEKLFR
SPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGPERPFPCHICGKGFITLSN
LSRHLKLHRGMD
Download sequence
Identical sequences ENSDORP00000003450 ENSDORP00000003450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]