SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003479 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003479
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily POZ domain 4.08e-26
Family BTB/POZ domain 0.00066
Further Details:      
 
Domain Number 2 Region: 361-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000013
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003479
Domain Number - Region: 187-195
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003479   Gene: ENSDORG00000003720   Transcript: ENSDORT00000003720
Sequence length 540
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4443:5154:7811:1 gene:ENSDORG00000003720 transcript:ENSDORT00000003720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGTVTGAGGGGTAAGVAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGGDS
PPQMPLPPPPPPPPPRPVVRRSRKPRKAFLQTRGARANHQVPEVPIVPTNPLAFEEEEVV
GRVGSSGGSGLGDSYSPPTGTASPTEGSLSYEPFEGEEEEEELAYPSAYGLAQGSGPPLS
PEELGSDEDAIDPDLMAYLSSLHQDALAPGLDGQDKLVRKRRSQMPQECPVCHKIIHGAG
KLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKN
HMHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTATP
SPAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDEEEEEGTPTTPQAEGAMESS
Download sequence
Identical sequences ENSDORP00000003479 ENSDORP00000003479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]