SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003489 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003489
Domain Number 1 Region: 61-248
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.63e-32
Family Diacylglycerol kinase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003489   Gene: ENSDORG00000003733   Transcript: ENSDORT00000003733
Sequence length 376
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_53:740:69277:1 gene:ENSDORG00000003733 transcript:ENSDORT00000003733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPLNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTVVKTDYEGQAKKLLELMESTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGQTSSLSHTLFADSGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKISKYWYLGPLKIKAAHFFST
LQEWPQTHEASISYTGPKERPPSEPEEIPPRPSLYRRILRRLASYWAQPQDALSQEVSPE
VWNDVKLSTIELSITTRNSQPDLMGKEDFMNICIEPDTVSKGDFITIGSKKVRNPKLRAD
GTECLQASRCTLLLPE
Download sequence
Identical sequences ENSDORP00000003489 ENSDORP00000003489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]