SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003508 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003508
Domain Number 1 Region: 171-221
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003508
Domain Number - Region: 14-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0165
Family Zf-UBP 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003508   Gene: ENSDORG00000003756   Transcript: ENSDORT00000003756
Sequence length 340
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4948:53688:140109:1 gene:ENSDORG00000003756 transcript:ENSDORT00000003756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVGAALEELPHDGTCDECEPDEAPGAEEVCRECGFCYCHRHAEAHKQKFLSHHLAEY
VHGAPAWTSRAPGEVAGKEDLEVQGEPDREIESEAGEEESESEGDSESEEESETEEESDE
ESEEDSEEEMEDEQESEAEEDNQEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGL
DLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFK
SSDPKVTRDQMKIFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMD
RLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Download sequence
Identical sequences ENSDORP00000003508 ENSDORP00000003508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]