SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003606 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003606
Domain Number 1 Region: 37-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000134
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003606
Domain Number - Region: 105-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00803
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003606   Gene: ENSDORG00000003859   Transcript: ENSDORT00000003859
Sequence length 269
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3288:6125:12115:1 gene:ENSDORG00000003859 transcript:ENSDORT00000003859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISSTIMDVDSTVSSGRSTPAMMNGQGSTTSASKSLAYGCHWDQCQACFSSSPDLAEHIRS
LHVDGQRGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVVGGCSASFASQGG
LARHVPTHFSQQNSSKVSSQPKAKEESPSKAGVNKRRKLRNKRRRSLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIAKRKEDSGKIKLLLHWMPEDILPDVRVNE
SERHQLKTKVVHLSKLPKDTALLLDPNIY
Download sequence
Identical sequences ENSDORP00000003606 ENSDORP00000003606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]