SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003620 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003620
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.58e-75
Family Crystallins/Ca-binding development proteins 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003620   Gene: ENSDORG00000003876   Transcript: ENSDORT00000003876
Sequence length 175
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4604:19036:20913:-1 gene:ENSDORG00000003876 transcript:ENSDORT00000003876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKITFYEDRSFQGRCYECSTDCPNLQTYFSRCNSIRVDSGCWMLYEQPNYQGRQYFLRR
GDYPDYQQWMGLSDSIRSCRLIPQHSGTYRMRIYERDEFRGQMSEITEDCISLQDRFHFN
EIHSLNVLEGSWILYEMPSYRGRQYLLRPGEYRRYLDWGATNAKVGSFRRVMDFY
Download sequence
Identical sequences A0A1S3GPY7
ENSDORP00000003620 ENSDORP00000003620 XP_012890948.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]