SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003621 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003621
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.68e-33
Family Crystallins/Ca-binding development proteins 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003621   Gene: ENSDORG00000003878   Transcript: ENSDORT00000003877
Sequence length 90
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4604:29327:29599:-1 gene:ENSDORG00000003878 transcript:ENSDORT00000003877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSHRIRLYERDDYRGLVSELTEDCSCIHDRFRLNEIYSLHVLEGCWILYEMPNYRGRQY
LLRPGDYRRYHDWGAMDAKVGSLRRVIDVY
Download sequence
Identical sequences ENSDORP00000003621 ENSDORP00000003621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]