SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003686 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000003686
Domain Number - Region: 347-419
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00049
Family Autophagin-like 0.011
Further Details:      
 
Domain Number - Region: 186-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00239
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 3-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0146
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003686   Gene: ENSDORG00000003947   Transcript: ENSDORT00000003946
Sequence length 573
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1031:97868:319980:-1 gene:ENSDORG00000003947 transcript:ENSDORT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCCDICGETVASEPDMKTHLLIVHMENEITCPFCKLSGVNYDEICFHIETAHFEQNTVE
GNFERTDTTQFGISDNKDNTLQSTGEVNSSDHSACASNPPKSSAQSLPKDVPLKQEAFYS
ENLRSRKLKSEKQSGLSEIKGSTYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXQPLYDCPMCGLLCTNYSILQEHVNLHLEESTYRQGMDEVQCSSDLELAFQLQKQED
RKRKSEESRQEMEGFQKLQRQYGLDNSGGYKQQQLRQMEIEVNRGRMPPSEFHRVKAGMM
ESLALGIDDGQTKTSGIIEALHRYYQNIATDVRHVWLSAVVDHFHSSLGDKGWGCGYRNF
QMLLSSLLQDDTFDDCLKGMSIPCIPKIQAMIEDAWKEGFDPQGASQLNNRLQGTKAWIG
ACEIYTLLTSLRVKCRIIDFHKPTGPLGTHPRLFEWILNYYSSEREGDSKVVCTSKPPIY
LQHQGHSRTVVGIEERKNRTLCLLIFDPGCPSPEMQKLLKQDIEASSLKQLRKFVGNLKH
KQYQIVAVEGALSPEEKIARRQASQVFTAEKIP
Download sequence
Identical sequences ENSDORP00000003686 ENSDORP00000003686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]