SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003692 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003692
Domain Number 1 Region: 67-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 109-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000128
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003692   Gene: ENSDORG00000003955   Transcript: ENSDORT00000003955
Sequence length 679
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4692:10721:44490:-1 gene:ENSDORG00000003955 transcript:ENSDORT00000003955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVKQEITFTDVSEQLMRDKKIREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHV
CEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDEC
GMRFIQKYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKG
GLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKDNALDKSDLKKDKNDYLPLYSSS
TKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTIS
PLSTYEESKVSKYAFELVDKQALLDSEGNADIDQVDTLQEGPSKPVHSSTNYDDAMQFLK
KKRYLQAASNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILDSQALNVEIKSNHD
KNVIPDEVLQTLLDHYSHKANGQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAYLNSPSLNFVTDNQTFNQPASSIDKQVYAAM
PINSRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKA
EAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVN
DNRAGMTSSPDATTGQTFG
Download sequence
Identical sequences ENSDORP00000003692 ENSDORP00000003692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]