SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003752 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003752
Domain Number 1 Region: 404-579
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.75e-33
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.039
Further Details:      
 
Domain Number 2 Region: 159-229,337-400
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-28
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.07
Further Details:      
 
Domain Number 3 Region: 54-131
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000557
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 4 Region: 7-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000193
Family Classic zinc finger, C2H2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003752   Gene: ENSDORG00000004018   Transcript: ENSDORT00000004018
Sequence length 861
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6145:23884:35780:-1 gene:ENSDORG00000004018 transcript:ENSDORT00000004018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGSDVEALPRGGFRCSLCQVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFV
SGFPRDVDSAQLSEYFQTFGPVASVVMDKDKGVFAIVEMGDVSAREAVLSQPQHSLGKHR
LRVRPREQKEFQSPAAKSPKGVSPDSHQLAKALAEAPDVEAQMVQLVGLRELSEAERQLR
NLVVALMQEVFTEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGDMEEPQLASKAPESPS
LDSALASPLDPQTLACTPASPLDSQPPASPQDSEALDLEIPSSSLAPQTPDSALASETVA
SPQSLPPASPIQEDRGEGDLGNAQEQAEALKEKPEGAAMLELVGSILRGCVPGVYRVQTV
PSARRPVVKFCHRPSGLHGDISLSNRLALHNSRFLSLCCELDRRVRPLVYTIRCWAQGRG
LSGSGPLLNNYTLTLLVIYFLQTRDPPVLPAVAQLTQKAGEGEQVEVDGWDCSFPRDASR
LEPSMNVEPLSSLLAQFFSCVSSWDLRDSLLSLREGQALPVAEVPSNLWEGLRLGPMNLQ
DPFDLSHNVAANVTSRVAGRLQNCCRAAANYCRSLQYQQRSSRGRDWGLLPLLQPSSPSS
LLSATPIPFPPAPFPQLTDVLVRVLREALGCHIEQGTKRPRSEGGRTESPQGGTSKRLKL
DGQRKNSEEGKEEQQGYEEDHGEDRVEEMVIEAGEVPQDWAMRSPGQSGELPIMTTLSRH
LTEQRPMAPEMAGDGSQGEPGKGASYPTLVSWRCALWHRVWQGRRRARRRLQQQSKTGDG
NKAISGAEWLAMEAQVTQELRETNAAEQTPDTEPLLTFVASASQAEQTLTVTPLQDSQGL
FPDLHHFLQVFLPQALRNLLK
Download sequence
Identical sequences ENSDORP00000003752 ENSDORP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]