SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003824 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003824
Domain Number 1 Region: 51-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-32
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 228-288
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 3 Region: 730-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 809-861
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 942-994
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-16
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 493-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000181
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 578-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000568
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 659-701,729-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000299
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 839-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000975
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003824   Gene: ENSDORG00000004094   Transcript: ENSDORT00000004094
Sequence length 996
Comment pep:novel scaffold:dipOrd1:scaffold_33077:6406:14070:-1 gene:ENSDORG00000004094 transcript:ENSDORT00000004094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWNFVHPVRAQAPRGRGRLSKIKKEEEEDEGYTLGETARPQTLNHAGQELFRQLFR
QLRYHESSGPLETLSRLRELCRWWMRPDVLSKAQMLELLVLEQFLSILPGELRAWVQLHS
PVSGQEAVALLEELPRDFDGTSQMDPSPVSQAVHWLGTGALQSPQIQPEASSLGNSSAPW
DHLEPPSEIGVHDFLSRQSDTPSVQVSDPSQKEESPGDQVPTRSLTAQPHEALTFKDVEV
IFSQDEWGCLNSAQRNLYQDVMLENYGTLASLVGSFSKPALISWLETREPWGLNIYTVQP
EGETDTACPEGGELQPQTSNPELSRTHEIDVPSEHPLTDIQEETGLRDSVEQENNDVHLP
CGNPIQVRVKTEETTFSPGIGDESQGSEQSNTFNLKPSTCSKTSRKKRALKHGRGRPFRK
NSHPYDYKKYGKGLRHAQRALSLHPRIPIDTKENEKDTCGKSFSLPSPPPQEPTPDNPGM
LNTSTDCGTPFHPSPHLLHPRLPTPEKIFKCRVCEKAFKWNSNCLRHEKIHTGVKPYKCS
ICEKAFQRLSAYRLHQHTHAKQMAGLGYHVREQNGEKYLDCSHCGKSFHCKSYVLEHQRI
HTKEKPYRCGSCRKSFRWRSNFNRHVRQHREQEEGRQHSTPQDPPTEEKTFHRPPPKNTF
NPKKKLLEHQIVHSRDKLYQCNECGQGFAFRSAFIVHKKNHAIQRKTEGQRLSLGQETAC
AAPHSRGNAEEKPYKCSQCDKVFRHHSFLLIHQRVHTREKPYQCKECGKAFRWTSNLYRH
QRIQSLHYKYRRAPKEAPSPQPDSPSDGKHFWCQECGKTFTRKRSLVDHMGIHSGEKRYK
CNLCGKSYDRNYRLVNHQRIHATDRPFISQWCGKEFRDLHTFSLHPKAHTRVAQTKRTRP
TQTDAQVQEFKAGGTKSLESSEGPSTQDSVVPELPNRPTEKKGHKCNLCGKAFCKNSLLL
SHKRFHTRERPFKCAVCGKTFRWSSNLARHMKNHID
Download sequence
Identical sequences ENSDORP00000003824 ENSDORP00000003824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]