SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003872 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003872
Domain Number 1 Region: 92-258
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000471
Family Pentapeptide repeats 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003872
Domain Number - Region: 489-539
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0087
Family Canonical RBD 0.017
Further Details:      
 
Domain Number - Region: 948-990
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0374
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003872   Gene: ENSDORG00000004146   Transcript: ENSDORT00000004147
Sequence length 1122
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4719:32423:88565:1 gene:ENSDORG00000004146 transcript:ENSDORT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGDSRSANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGH
SGPPFANVEEHSFSYGARDGLHGDYRGGEGPGHDFRGGDFSSSDFQNRDSSQLDFRGRGI
HSGDFRDREGPPMDYRGGDGTPIDYRSRETPHMNYRDRDAHTIDFRGRDAPPPDFRGRGN
YDLDFRGRDGSHADFRGRDLPDLDFRTRDQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGS
GTTDLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGPCMEFKDREMPPLDPKILDYIQPST
QDREHSGMNVNKREESTHDHTVERPAFGNQKGEFEHSETREGETQGVAFEHESPTDFQDN
QNPIQEKEKSQLSGGEQQSSDAGLFKEEGNLDFLGRQDTDYRSMDYRDVDHRLPGSQMFS
YGQSKSFPEGKTARDAQQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNAFRNPD
GMPVKELQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIHDKEVTLEYVPSPDFW
YCKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNR
QGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGSPEEEEIKEKKPTNQGK
SSSKKEVSKRDSKEKKDRGMTRFQENVSEGKPPPEDVFKKPLPPTVKKEESPPPPKVVNP
LIGLLGEYGGDSDYEEEEEEEQTTPLQPRTAQPQQREELTKKENEEDKLTDWNKLACLLC
RRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGRFKEKGNDREKLQ
SFDSPERKRIKYSRGSDSDHNPVDKEDLDTSSKGGCAHQTTGWRKGAGLGYSHPGLGSSE
ETEGRMRGPGVGTPGRISKRQSNETYRDAVRRVMFARYKELD
Download sequence
Identical sequences ENSDORP00000003872 ENSDORP00000003872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]