SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003943 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003943
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-26
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003943   Gene: ENSDORG00000004220   Transcript: ENSDORT00000004220
Sequence length 497
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5804:4799:6606:1 gene:ENSDORG00000004220 transcript:ENSDORT00000004220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMV
RYLLEQGADPNIADRLGRTALMHACAGGGGAAVAALLLAHGADPSVRDHAGASALVHALD
RGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPAPRSPGV
CTSPSEIQLQTAAGGGGSGMLSPRAQEEEEKRDIFEFPLPKPPDDPSPSEPLPKPPRHPP
KPLKRLNSEPWGLVAPPQPVPPAEGRPGAERLAAEFNGLTVAGRPRLSRRHSTEGPEDPP
PWAERVAGGGPLSRRNTAPEAPEAPAGWRQKLSRLEPVEPDGPGHLGSDSPEPSRPALER
RRYSASPLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERRGSGTLLLDHISQTR
PGFLPPLNVSPHPPIPDIRPQPGGRAPSLPAPPPPHAGAPGSPRTKRKLVRRHSMQTEQI
RLLGGFQSLGGPGEPGR
Download sequence
Identical sequences ENSDORP00000003943 ENSDORP00000003943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]