SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003956 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003956
Domain Number 1 Region: 1157-1252
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-19
Family BRCT domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 1112-1154
Classification Level Classification E-value
Superfamily BRCT domain 0.00000276
Family BRCT domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003956   Gene: ENSDORG00000004235   Transcript: ENSDORT00000004235
Sequence length 1258
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_484:50478:100772:-1 gene:ENSDORG00000004235 transcript:ENSDORT00000004235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQESTRFSQLVEELLRIIHAFELDTGLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKKFRQNESQNSTQVSLSVQLSKLGIVSSLKTKKQIQPQNKSVYIELGSDSSEETSYI
SNYCPKVQTNSRYDSDSSDKTNTPFTNCSNKEESVGPSLEREIEENLETIEVPNLTKDPR
DRLVNGERAMPTELSADSTSLSWTPDSEYDTQDSISLLEINPLRRGKTASNQCEIQYEAV
GNPNHIIHDCSKTTRHDTEGFMDPLRQEDSHMLESDIETEESELDTQYLQNTFQDSKRQS
FALFSNSGNPEKECATVSAHSISLSKQSPNVILEYKQRENHQDKESKTRLAQAIKATTDF
PVICQKHEPGDNAECSSSIAKTSGLCPSSQLTANELTSANKLRILQNSYLIPSISPVRPS
VKTKCKQMFEKQSMSSEEGLESESIIQSTLCMFSPNNIENAFKGASPGSINEVGSSTTGG
GSSINEVASSVENIQEELNRSRGPELNAVLRLGHTQPEAYNQTLPVSNCKHPEIKEQTEN
EGVVQVVGADFSPCLISDTLETGMTSNDVSQICPETPEDLLYNDEIKENTSFTEGAIEET
SAVFSKSIQKREFSQSPSPSLTSTSLAQGLKDDDLPSFRHFLFSKVTNTPFQSIRHTIKC
LSHETEENPVSLRNSLQVNNNEILVEASQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSGLVSDDEEREPDLEEEERTDSNLGEAASGYDSE
TNLSENISEVSSQNDFLTSQQKHIMKDNLKKIQQEMAHLEAVLQQHKSQQLPASSTSLLA
NYCGPEQNVSGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSPSK
TQLVDSSGSVHYLSTRLQNRNFPSQRELVVIDLEEEQLEKSQPPDLMEQSYLPKQDLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVSYWVTQSIKEGKVLDEHDFEVRGDVIN
GRNHQGPKRARESQEKLFTGLEICCYGPFTNMAIDQLEWVLQLCGASVVKELASTTVGTH
SPLIVVIQPDAWTEDSSFQAISQLCEASVVTREWVLDSVALYKRQDLGTYLITQIPYR
Download sequence
Identical sequences ENSDORP00000003956 ENSDORP00000003956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]