SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003970 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003970
Domain Number 1 Region: 1125-1177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 994-1044
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000139
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 443-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000128
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 698-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000566
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 735-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000616
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003970   Gene: ENSDORG00000004249   Transcript: ENSDORT00000004249
Sequence length 1317
Comment pep:novel scaffold:dipOrd1:scaffold_4086:26696:40835:1 gene:ENSDORG00000004249 transcript:ENSDORT00000004249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLL
HKKNCTKNQLVLIVSENPATPPKTFSPSPPPENPEEQMKDPMKKTDQVDCNDLSEHKGLD
GEESMEVEAPVAPSSDNSTLNSVTNNNPPSCHSGSSTGTSAITTSLPQLGDLTTLGNFSV
INSNVIIENLQSTKVAVAQFSQEARCGSGSAGGSGGQRAVPALMEQLLALQQQQIHQLQL
IEQIRHQILLLASQNADSPTSSSPSQGTLRTSANPLSTLSSHLSQQLAAAAGLAQSLASQ
SASISGVKQLPPIQLPQSSSSNTILPSNNGTSPNINILAATVTTPSSEKVASSAGASHVS
SPAVLASSSPAFAISSLLSPASNPLLPQPTPANVVFPSPLPNIGTTAEDLNSLSALAQQR
KSKPPNVTAFEAKSTSDEAFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRF
STKGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTSWLDTKP
VLPTLTTSVGLPLPPTLPSLTAFIKTEEPAPIPISHSAASPPGSVKSDSGVPDLATRNLG
GLPEEAEGSTLPPPGGKSEDGGTATSSVPTANSNPLSSPAADCGPGGTTTFTNPLLPLMS
EQFKAKFPFGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSALKMHYRT
HTGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAVVLQQHIRM
HMGGQIPNTPVPDSYPESMESDTGSFEEKNFDDLDNFSDENMEDCPEGSIPDTPKSADAS
QDSLSSSPLPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSVEGDVLTNDSSSVGG
DMESQSAGSPAISESTSSMQALSPSNSTQEFHKSPSTEEKPQRVGPSEFANGLSPTPVNG
GALDLTSSHAEKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHYRSHTKER
PFICTVCNRGFSTKGNLKQHMLTHQMRDLPSQLFEPSSNLGPNQNSAVIPANSLSSLIKT
EVNGFVHVSPQDSKDTPTSHVPSGPLSSSATSPVLLPALPRRTPKQHYCNTCGKTFSSSS
ALQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTPARRGRRLSVDGPMSFLG
GNPVKFPEMFQKDLATRSGSGDPSSFWNQYTAALSNGLAMKANEISVIQNGGIPPIPGSL
GSGSSSPISGLTGNLEKLQNSEPSAPLAGLEKMTSSENGTNFRFTRFVEDSKEIVTS
Download sequence
Identical sequences A0A1S3G578
ENSDORP00000003970 XP_012883444.1.60039 ENSDORP00000003970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]