SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004086 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004086
Domain Number 1 Region: 38-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-38
Family SCAN domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 382-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 302-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 189-231
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000942
Family KRAB domain (Kruppel-associated box) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004086   Gene: ENSDORG00000004372   Transcript: ENSDORT00000004371
Sequence length 446
Comment pep:novel scaffold:dipOrd1:scaffold_15855:1870:5120:-1 gene:ENSDORG00000004372 transcript:ENSDORT00000004371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLQGSQDQASGEGEGLLIVKVEDSSWEQVSAQPEDSRDLEACRQRFRQFCYEDVGRPH
EAFSQLWELCCRWLRPELRSKEQILELLVLEQFLTVLPKEIQTWVQGQHPGSGEQAVALV
EDLQKQPVKGWPQDVCSEELGPEVAVQRSRSKRLPLVVGVQSQPPVPWEPRRHQLPAHLK
EGRGREGTSAHGPVALGDVPFFFSQEEWGSLDPAQRDLFWDIKQESSRNTVLDLGLKSLS
VETGLAEVAMALPAPAGGGAGGQAAVAWSPEKAETWESENLPGTALPPPLRRRQFRDLAS
EKQHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPACDKSFRSSSDLVRHQGVHTGQKPF
SCTQCSKSFSRSAYLADHRRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCAE
CDKSFKQRAHLIAHQSLHAKTAQPVG
Download sequence
Identical sequences ENSDORP00000004086 ENSDORP00000004086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]