SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004090 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004090
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-22
Family SCAN domain 0.0002
Further Details:      
 
Domain Number 2 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 593-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 442-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000117
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 267-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000593
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 9 Region: 400-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004090   Gene: ENSDORG00000004373   Transcript: ENSDORT00000004376
Sequence length 701
Comment pep:novel scaffold:dipOrd1:scaffold_15855:21744:25817:1 gene:ENSDORG00000004373 transcript:ENSDORT00000004376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRASLSRLRELCCHWLQPSLHTKKQILELLVLEQFLSVLPPHLLGRLQGQCLRDGEEV
VLLLEGVSRDTGHVGPLDFSXXXXXXXXXXXXXXXXXXXXXXXXXXXPKKEAPPEEPSVP
CPASEPPPSQACQAAEHAEWRLLSSKPPLSPGPQRTLFTLHENTPQDHSWPEENSRDKEM
AAKELAAVLETLSFEDAPEKKSVYPHEFISRITDSEDFKQAEPKGAAWPPIFSAESPADS
AVVGGEPLPARPGGGAGGSAGADRAHFLCTECGASFPKLSRLETHQLSSHPGHRSFACPH
CAKTFGRSSILKLHLRTHTDERPHACHLCGHRFRQSSHLTKHLLTHSAEPHFRCAECDQG
FQRRSSLVQHLLAHAQDPAPPWTPRMLRTQSPPGTPRPPVFLCSRCGQTFQRRSSLKRHL
RIHGADGRGRGGGRGRAGRESRPYKCADCGKAFRRGEHLVTHWRVHTGERPFSCRACGRS
FTQSSQLASHQQVHSGERPHACPQCGKRFLRRAGLARHLLTHGGPRPYRCGQCGKTFTQT
QDLTRHVRSHTGEKPCRCSQCGEGISQNAHLTRHQRIHTGEKPHACDTCGHRFRNSSNLA
RHRRSHTGERPYACPTCGRSFRRNAHLQRHLVTHTGAGPEVEAPQECPECGKSFSRSCNL
LRHLLVHSGARPYACAQCGRSFSRNSHLLRHLRTHARETLY
Download sequence
Identical sequences ENSDORP00000004090 ENSDORP00000004090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]