SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004139 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004139
Domain Number 1 Region: 79-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.4e-44
Family Reprolysin-like 0.0027
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 1051-1112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 1002-1056
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 5 Region: 744-803
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004139
Domain Number - Region: 877-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00262
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 1180-1252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0916
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004139   Gene: ENSDORG00000004424   Transcript: ENSDORT00000004427
Sequence length 1317
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4433:13317:49229:1 gene:ENSDORG00000004424 transcript:ENSDORT00000004427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQYLPGVAQRPLLAASIRGFLTGAFFVLGCWGFPDFQQDFFQDLEPKDVSSNFGPDAAS
AGLLSPGLQRRRWAAGDILYLELLVVVGPDVYQVHQEDTERYILTNLNIGSELLKDPSLG
AQFRVHLVKLMILMEPEDAPNITANITSSLQSVCEWSQTINPTDDSAPGHADLVLYVTRF
DLELPDGNRQVRGVTRLGGLCSPSWSCLITEDTGFDLGVTIAHEIGHSLGLDHDGTQGGG
CGSSGHVMASAGAVSRAGLGWSSCSRRQLWQLLRAGRARCLWDQPGPQSRPVGFPQDAQP
GLYYDADQQCRIAFGPRAAACTFAREGLDACQALSCHTDLLDHSSCSRLLVPLLDGTECG
MAKWCSKGHCRSLAELSPVAAVHGHWSGWGLRGPCSRTCGGGVVLRRRQCNNPRPAFGGR
ACVGAEFQAEMCNTQACEKTQLEFMSEQCAQTNNRPLSLSRDSPSFYHWGAAAQYSQGDA
LCGHLCWAVGESFMVRRGDRFVDGTRCVRGRPHQDGTLSLCVSGSCRAFGCDGRMDSLQV
WDACQVCGGDNSTCSLRNGSFTAGRAGEYVTFLMVTPSITGVHVVNRRPLFTHLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXWAAGDFGPCIASCGGGLRERLLRCVEAQGGLLRTLP
PTQCRAVAHKPVPEVEACNHWPCTARQGVSALASTTRMQGAGGLEAAVTVGPCSPDETPP
APEPCVGRACPPGGGQVDTTSPAEEAPFPTGSIRPGAVHVWTPLVGPCSVSCGRGSMNLH
FLCMDSVLRTPVQEDLCDLATKPGTRQEVCQADPCPVXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKVLSLGPCSASCGLGTAART
VTCVQRDGGQDAEVDEALCAALVRPQASVPCLTAHCAYQWHVGTWTPCSVSCGEGVQYRR
DTCLEAQSPVPASFCQHLPKPVTVRGCWVEPCERPGTPSPAPHQEATAPGQSTAAVAGDP
LPWPWAGLPVPAPQPPEPQESPAESGTCGYEPTGTIDMGTGHGDCVVAIGHPLGEVLTLQ
VLKSSLNCSVGEVLLPWGPFTWRKMCQQLSGMTFLSKTNTLGVKQWSTRSREGVVLWYRS
QAAWGTFYRECAAQRCGPRGEPGSAPRRAAGCRSGAAPRARSAGHARIAARDEARAG
Download sequence
Identical sequences ENSDORP00000004139 ENSDORP00000004139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]