SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004154 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004154
Domain Number 1 Region: 99-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000387
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004154   Gene: ENSDORG00000004442   Transcript: ENSDORT00000004442
Sequence length 134
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6576:70925:72959:1 gene:ENSDORG00000004442 transcript:ENSDORT00000004442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GANSQWESTPGFPGPNKPDLTAGPNLWPPASSQPYELYDPEEPTSDRTPPSFGGRLNHSK
QGFSGGRRRAKEEQALLPAVGPLQAQELNDFHGVAPPHLPHLCSLCDKKVFDLTDWELHV
KGKLHTQKCLLFSE
Download sequence
Identical sequences ENSDORP00000004154 ENSDORP00000004154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]