SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004187 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004187
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.7e-40
Family Crystallins/Ca-binding development proteins 0.0000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004187   Gene: ENSDORG00000004477   Transcript: ENSDORT00000004476
Sequence length 149
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1056:795:6259:1 gene:ENSDORG00000004477 transcript:ENSDORT00000004476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADHQTQAGKPQPLNPKIIVFEQENFQGHSHELSGLCPNLKDTGVEKAGSVLVHAGPWV
GYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKITLYENPNFTGK
KMEIVDDDVPSFHAHGYQEKVSSVRVQSG
Download sequence
Identical sequences ENSDORP00000004187 ENSDORP00000004187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]