SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004211 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004211
Domain Number 1 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 387-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000261
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 308-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000746
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000144
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004211   Gene: ENSDORG00000004502   Transcript: ENSDORT00000004501
Sequence length 451
Comment pep:novel scaffold:dipOrd1:scaffold_20399:10933:15564:-1 gene:ENSDORG00000004502 transcript:ENSDORT00000004501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPVTLKDITVEFSKEEWKLLTPAQKTLYKDVTLDNYNLLVSVGYRVSKPAIVLKLKQGKD
PWSLEVECPRRKHPEKVKNVQNPRGRSQKSQTGNSRNREPARPQKTQKQQESYDCNECGK
SFCTKSALTVHQQTHSKDISYECEKCGKSFSKNEDLTKHQKVHTRDKTYECKECKSIFYH
LSSLSRHLRTHAGDKPYECKQCEKSFYQKPHLMEHQKTHTGEKPFKCTECGKFFYMKAYL
LVHQKTHTGEKPFQCKECGNFFSQKSHLTVHQRSHTGEKPYKCKECGKLFSRNSHLKTHQ
RTHTGEKPYECKECKKCFYQKSALTVHQRTHTGEKPFECSKCGKHFYYKSDLTKHERKHT
GEKPYECADCGKSFSVNSVLRLHQRTHTGEKPYECEECGKCFSQRSHFIIHQRKHTGEKP
YECQECGDTFIQKSQLNAHRKTHAQKGNADK
Download sequence
Identical sequences ENSDORP00000004211 ENSDORP00000004211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]