SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004227 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004227
Domain Number 1 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 486-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 401-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 342-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000038
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000183
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 440-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000457
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004227   Gene: ENSDORG00000004518   Transcript: ENSDORT00000004517
Sequence length 665
Comment pep:novel scaffold:dipOrd1:scaffold_4075:40808:45028:-1 gene:ENSDORG00000004518 transcript:ENSDORT00000004517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQLTLEDVAVDFTRGEWRCLTPAQRALYRDVMLDTYRNLVSVGVSPPSVSVILPLELEEE
PWVAQSHVTTPGELNGWKGAKGVSAGTSSKHIIKELPPHAGSCRGEITQSHEDGGTDEFS
CEEVQKALREWEWEWSSTEGRAKGVLVVHREEGSGGGKQEGGGHARKQPTSPWLRRPLQE
PLRGLPPYLCEGPRVRTKVETSTLEGVPMSRSQESPSSGNTHIAHACDDAPICSPLCTRK
PKAHIQEKPYKCREGEKTCSYRLSLVHHRQSRTGEKLHHCTECGKAFSTRSCLLVHVQCH
RGMKHYQCGMCGNGFSKLSNLLVHEQHHSGVKPHRCPVCGKVFNQLSSLTVHCRSHAGER
PCPCGNCSEAFVVRSGLTKHQVLHTEVKPHRCTECGKAVSQGSSLAVHRRTHAGERLYCC
ARCGKAFTRKSGLVRHNRTHTGERPYACGLCSKASAHMALTAHQTVHSGQKPHRCSECGK
AYSHAPLAIHRRTHTGERPYSCDTCGKAFTIRKSLTEHQVVHTGARPYHCAQCGKTFTQN
SQLVRHRRIHTGEKPYTCDTCSKAFSSRKSLTEHQAVHTGVKPYRCAQCGKTFTRNAQLA
RHRRTHTGERPYVCADCGKAFYSHSNLTAHRTIHAEFKPYQCNECGKAFTQNMHLVRHLK
HTRER
Download sequence
Identical sequences ENSDORP00000004227 ENSDORP00000004227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]