SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004244 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004244
Domain Number 1 Region: 585-673
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.34e-25
Family Eukaryotic proteases 0.0000169
Further Details:      
 
Domain Number 2 Region: 133-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-19
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 3 Region: 258-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-17
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 4 Region: 7-83
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000196
Family SEA domain 0.018
Further Details:      
 
Domain Number 5 Region: 481-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004244   Gene: ENSDORG00000004534   Transcript: ENSDORT00000004534
Sequence length 673
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3888:2639:20932:1 gene:ENSDORG00000004534 transcript:ENSDORT00000004534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNVRVQKVFNGYVRIKNENFIDAYENSNSSEFISLANKVKEALKLLYSEVPVLGPYHKKS
AVTAFSEGSVIAYYWSEFSIPQHLEEEAERAMAVERVITLPPRARALSSFVMTSVVAFPS
DPRSVQRTQDNSCSFALHARGGELTRFATPGFPDSPYPAHARCQWALRGDANSVLSLTFR
SFDVAPCTGQNSDLVMVYDTLSPVEPHAVVQLCGTYPPSYNLTFLSSQNVFLVTLITNTE
RRHPGFEATFFQLPKMTCGGNLREAQGTFSPYYPXXXXXXXXXXXXXXVPNNQNVKVRFK
LFYLLDHDMQPGTCSKDYVEINGEKFCGERSPFVVSSNSNKMTVRFHSDHSYTDTGFLAE
YLSYDSRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
VVPCTKYTYRCQNGLCLSKGNPECDGKKDCSDGSDEQHCXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSDPAMWVVYLGLLDQSN
RSASGVQEHRLKRIITHPSFNDFTFDYDIALLELEKPAKFSTVVRPICLPDTSHVFPAGK
AIWVTGWGHTQEG
Download sequence
Identical sequences ENSDORP00000004244 ENSDORP00000004244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]