SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004246 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004246
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily POZ domain 5.76e-34
Family BTB/POZ domain 0.00064
Further Details:      
 
Domain Number 2 Region: 397-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000728
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004246   Gene: ENSDORG00000004536   Transcript: ENSDORT00000004536
Sequence length 571
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3888:51982:75576:-1 gene:ENSDORG00000004536 transcript:ENSDORT00000004536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKL
VGQAEDENKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTC
SEFMKSSILWNTPNSQPEKGLDAGQENNSNCNFTSRDGSISPVSSECSVVERTIPVCRES
RRKRKSYIVMSPESPVKCSTQTSSPQVLNSSASYTENRNQPVDSSLAFPWNFILFGIDRR
VLPEKAKQPENTRTSELPGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHML
IHSGIKPFQCDRCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFLVPDYLNQEQEENL
VQYDLGEHSFESNSSVQMPVISQYHSKGKEP
Download sequence
Identical sequences ENSDORP00000004246 ENSDORP00000004246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]