SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004275 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004275
Domain Number 1 Region: 796-916
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-27
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 8.58e-18
Family BRCT domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004275   Gene: ENSDORG00000004567   Transcript: ENSDORT00000004566
Sequence length 1055
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2821:42137:114331:1 gene:ENSDORG00000004567 transcript:ENSDORT00000004566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGAPKHIIQMTGFKMEEKEALGKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWVLTKDYIIHSARSGRWLDETTYEWGYKIEKDSHFSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRADKRSDSLVRVLEAGKANIILPKSSPSGITHVIASNARINAEKEKD
NFKAPFYPIQYLGDFLLEKEIQNDEDSQTKSLWTEHGNQEKSKDFGNDMRLLEINSALRE
TMSRTQKEIQNHDEDVNSSSVLHEHHKKEKFRESSKDLKFVKMRNTFKRHTYGNQKETKK
KEDIQRNYTLRRKRRKETEGKNDVGHDTIKSSFKKHIYYRDQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAVRYNCIRVDXXXXXXXXIKNAEFPRGVLNLIESLIE
GQFFNEAIEELSSLQAHYIPPVCLLHALLENILQDNIDTFSGRYFHILSALLHLHPPWES
PAMSRYYLQLFQCPTCMKGSWSLVEVLIRSCLFNESFCHQIPESIGSKVLYLTLLKFFFN
LIETEVRNLSQKLYDWSDSQSLKITGKAIPLEIFWSGSETSGLLTKPVNLLLEWTIYSHK
EKCKSNDVFKHELAYLLTGILGVAIDYWIFSGLKMGRNVMRHMSDDLGSYISLSCDDFSS
QELEVFICSFSSSWLQMFVAEAVFKKLCLQNSSNVASEPLTLQKMVCSYLPALGKTGTHG
VGKIQILKKIGQRPCLESQRALLMLNGAKQKQVEGLPELPELTLTKCSSFKKLKKKSEGE
LSCSKENCPSIVTKMNFRKTNLKGETALHRACINNQVEKLILLLSLPGVDINVKDNAGWT
PLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGAVLL
QQRDSKGELPLDYVVSPQIKEELFAVTKIEDTVENFHAQTEKHIYHQQLEFGSFLLSRML
LNFCSIFNLSSEFILAFKGLTHLNELLMACISYKETTSSRTDWLLDLYARNIKTLQKLPG
ILKDLPENMKLCPGVHTEALLVTLDIMCRSITELS
Download sequence
Identical sequences ENSDORP00000004275 ENSDORP00000004275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]