SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004338 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004338
Domain Number 1 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 224-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000033
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 23-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000379
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 4 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000129
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 5 Region: 166-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000408
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004338
Domain Number - Region: 403-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00368
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004338   Gene: ENSDORG00000004634   Transcript: ENSDORT00000004633
Sequence length 499
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_146:4527:8152:-1 gene:ENSDORG00000004634 transcript:ENSDORT00000004633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGAAWAGVGATQAPGEAAAGAELFRDMAIISSQEEWECPELPQRLYKDVMLETYRNLIS
LGLTIFKPDVIFLEQGRMPWTEEWAATGGLGPVLELGCGIKVSFPKHPICAVALPQWDIM
ESLTSFSVEFPHFQDDWECSPCESQPGNPDRPFSQIAPRHEDLPAFTPPATLAFCLKTHI
GGKPSGYSEFRKDFWGEEFLLDPQGIHCGRKPCKCKECGKAFKHSSLIQHENIHSVKKPC
ECKECDKAFNSGLDFVHHPQVHTGEKLYVWTSCAKAFSCSSQLLKHWWIHTGEKPYVCMA
CAKAFNHISHLQVHRWVHTEEKPYKCQECGKTFAPRSQLMKHQTVPIGKKPHEGRECRKA
FSQGCIQHGIHMGESPYQCQLCSRTFSHVSHLMVHSRLHTGKKRHAFQEWGKASGHHSTL
LQPQPTPDEEACHKYEECGRPWSQDSATAQHQRLRTREARVNVVGIEKPPFSVHPLLILR
ELTLAGNHRNGVTGKSHVA
Download sequence
Identical sequences ENSDORP00000004338 ENSDORP00000004338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]